PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn352391
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family MYB_related
Protein Properties Length: 305aa    MW: 34513.4 Da    PI: 5.5872
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn352391genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.23.8e-18113158148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+eE+e +++++++lG++ W++Ia+t++ gRt++++k+ w+++l
       Achn352391 113 RGNFTKEEEETIIELHQKLGNR-WSAIAATLP-GRTDNEIKNMWNTHL 158
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.98E-20101165IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.5E-7101119IPR009057Homeodomain-like
PROSITE profilePS5129426.03108162IPR017930Myb domain
SMARTSM007171.8E-16112160IPR001005SANT/Myb domain
PfamPF002497.2E-16113158IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-23120159IPR009057Homeodomain-like
CDDcd001671.02E-6127158No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MEQEGRRNNS SPSAMLAALL CKRAKLHEDL RNIEKQVISY LSHSSRIQIV DICVYIDVDG  60
CFFPVREFVE LGFDHNVVIC IWAEDHAIGR DGGGISTNGQ LRWTNYLRPD IKRGNFTKEE  120
EETIIELHQK LGNRWSAIAA TLPGRTDNEI KNMWNTHLKK RLNQNKANPI TKQPRSTKMQ  180
TYGQVTEKES QPKNYDPNQI RLQSPQHSFS DMSSVTTAAA ADTVDNFSEM DERFWTDVFS  240
YDNSDEVSGS PAAAADPQAK FQVSSLHGVE NVYGYNSGMH EGNDMDFWYH LFSAAGKLQE  300
LPDF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C1e-169316236105C-Myb DNA-Binding Domain
1mse_C1e-169316236105C-Myb DNA-Binding Domain
1gv2_A1e-169316236105MYB PROTO-ONCOGENE PROTEIN
1a5j_A1e-169316339109B-MYB
1h8a_C2e-169316259128MYB TRANSFORMING PROTEIN
1h89_C4e-169316290159MYB PROTO-ONCOGENE PROTEIN
1h88_C4e-169316290159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011028802.14e-57PREDICTED: myb-related protein Myb4-like
TrEMBLB9GS154e-56B9GS15_POPTR; GmMYB29 family protein
STRINGPOPTR_0002s03960.11e-55(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G31180.15e-37myb domain protein 14